PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0868s0040.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family Dof
Protein Properties Length: 315aa    MW: 34308.1 Da    PI: 7.0383
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0868s0040.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof122.41.5e-383392261
                  zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61
                            +++ lkcprCds ntkfCyynny+lsqPr+fCk+CrryWtkGG lrnvPvGgg+rk k+s
  SapurV1A.0868s0040.2.p 33 NHQPLKCPRCDSLNTKFCYYNNYNLSQPRHFCKSCRRYWTKGGVLRNVPVGGGCRKTKRS 92
                            57899****************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074785.0E-273191IPR003851Zinc finger, Dof-type
PfamPF027014.0E-333591IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.6183791IPR003851Zinc finger, Dof-type
PROSITE patternPS0136103975IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 315 aa     Download sequence    Send to blast
MQDFHSIGGG SRYFSGGGGG GVDRRLRPHY HQNHQPLKCP RCDSLNTKFC YYNNYNLSQP  60
RHFCKSCRRY WTKGGVLRNV PVGGGCRKTK RSKPKQNSTP STASDTITTS TSRPQEQQER  120
DHMSSNSHSS SESSSLTAAN NSNANTAVEA VSALSVNSVS NKVFPRGDMN PSFETGLLEQ  180
GSDCGIFSEF GSFTNLIAST NDLSFGFSNT TNLQQQQGIE HHGQNNQNQQ QLQNQQQEMT  240
GGGLIDQTIH DELSALPSSS RSTENTGGGF GALDWQLGSG DQAGGFFYLP NNADQASWSQ  300
SQWNDQDQPS LYLP*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00570DAPTransfer from AT5G60850Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEF1480341e-172EF148034.1 Populus trichocarpa clone WS0126_P16 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002322044.21e-152hypothetical protein POPTR_0015s03520g, partial
TrEMBLA9PI211e-152A9PI21_POPTR; Putative uncharacterized protein
STRINGPOPTR_0015s03520.11e-152(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60850.19e-41OBF binding protein 4